PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G13150.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 409aa    MW: 44185.8 Da    PI: 6.7998
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G13150.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.6e-32236291156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  OPUNC02G13150.2 236 KARRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 291
                      68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.524233293IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-28234294IPR009057Homeodomain-like
SuperFamilySSF466895.73E-17234294IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-27236291IPR006447Myb domain, plants
PfamPF002491.8E-6238289IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MEVDHADRDR ARRRCREYLF ALEEERRKIQ VFQRELPLCF DLVTQTIEGM RSQMDGAGSE  60
ETVSDQGPPP VLEEFIPLKP SLSLSSSEEE STHANAAKSG KKEEAETSER HSSPPPPPEA  120
KKVTPDWLQS VQLWSQEPPQ QPSSPSPTPA KDLPCKPVAL NAGKAGGAFQ PFEKEKRAEL  180
PASSTTAAAS STVVGDSGDK PTDDDTEKQM ETDKDNNKDA KDKDKDKEGQ SQPHRKARRC  240
WAPELHRRFL QALQQLGGSH VATPKQIREL MKVDGLTNDE VKSHLQKYRL HTRRPSTTGQ  300
SSATAGVAAP PAPQFVVVGS IWVPPPEYAA AAAAQQHVQL AAGNASGSAN PVYAPVAMLP  360
AGLQPHSHRK QQQQQGQRHS GSEGRQSGDA GDGSSSSPAV SSSSQTTSA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0643550.0AK064355.1 Oryza sativa Japonica Group cDNA clone:002-108-B01, full insert sequence.
GenBankAK1018090.0AK101809.1 Oryza sativa Japonica Group cDNA clone:J033066M05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623779.10.0PREDICTED: two-component response regulator ORR22
TrEMBLA0A0E0JZ840.0A0A0E0JZ84_ORYPU; Uncharacterized protein
STRINGLOC_Os02g22020.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0127400.10.0(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.17e-63G2-like family protein